General Information

  • ID:  hor002501
  • Uniprot ID:  A0A921ZJJ1
  • Protein name:  AKSYNFGLamide
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  AKSYNFGL
  • Length:  8(129-136)
  • Propeptide:  MLSLLVPLWVVASALSVLSGALGEPERSGPVAAPAPPAALEKRSPHYDFGLGKRAYSYVPSVLVRPRQALGGGGSARGGYEVKRARPYSFGLGKRLAEDETSEEKRARMYDFGLGKRLPMYNFGLGKRAKSYNFGLGKRLSSKFNFGLGKRERDMNRFRFGLGKRSEGELPAAPAAAPADTDNYFDI
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in regulation of fluid transport;may have a myomodulatory or myotrophic function in larvae
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002501_AF2.pdbhor002501_ESM.pdb

Physical Information

Mass: 102405 Formula: C42H62N10O12
Absent amino acids: CDEHIMPQRTVW Common amino acids: AFGKLNSY
pI: 9.3 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -18.75 Boman Index: -508
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 61.25
Instability Index: -1003.75 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  9268127
  • Title:  Allatostatin-like-immunoreactive Neurons of the Tobacco Hornworm, Manduca Sexta, and Isolation and Identification of a New Neuropeptide Related to Cockroach Allatostatins